General Information

  • ID:  hor001723
  • Uniprot ID:  A6P3B2
  • Protein name:  MudFMRFamide-9
  • Gene name:  fmrf
  • Organism:  Musca domestica (House fly)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  In the brain, expressed in 2 large cells in the lateral neurons in each optic lobe, 2 slightly bigger cells on both sides of the tritocerebrum, around 14 small cells in the dorsal area, around 13 cells in the subesophageal ganglion, and in the central bra
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Musca (subgenus), Musca (genus), Muscini (tribe), Muscinae (subfamily), Muscidae (family), Muscoidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NPGSQDFMRF
  • Length:  10
  • Propeptide:  MVAPLLVFLFSLQLCHTTSWAYVGGNSLNSNSLHASYSEFPAGTSNEVPEDAANGQDDNDDSQLTEPNDNNAPLVQSIDDETEMQFPKPIQWVSIDHLRNSIILRFQNPTPKILNKLDPEEMKRLRSLQENAMRWGKRSYESYPLNRNGLADKSSVGRMGFLSNHQVIRDSRGDNFMRFGRSVGGSGGNDDNFMRFGRASGSSDFMRFGRAGQDNFMRFGRAAGQDFMRFGRGSGQDFMRFGRSPGSQDFMRFGRNPGSQDFMRFGRSPGSQDFMRFGRNPGSQDFMRFGRNPGSQDFMRFGRNPGSQDFMRFGRASGGQDFMRFGRAPSGQDFMRFGRPDNFMRFGRTPAQSSDFMRFGRTPTQSSDFMRFGKSLDKSENKTSDLQK
  • Signal peptide:  MVAPLLVFLFSLQLCHTTSWA
  • Modification:  T10 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A6P3B2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001723_AF2.pdbhor001723_ESM.pdb

Physical Information

Mass: 135902 Formula: C52H75N15O16S
Absent amino acids: ACEHIKLTVWY Common amino acids: F
pI: 6.34 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -103 Boman Index: -2997
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 2956 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18789334
  • Title:  Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.